missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193669

Invitrogen™ Human SLC5A11 (aa 544-632) Control Fragment Recombinant Protein

Product Code. 30193669
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193669

Brand: Invitrogen™ RP95801

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57232 (PA5-57232. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cotransporters, such as SLC5A11, represent a major class of proteins that make use of ion gradients to drive active transport for the cellular accumulation of nutrients, neurotransmitters, osmolytes, and ions Roll et al. (2002).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WWX8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 115584
Name Human SLC5A11 (aa 544-632) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010013B02Rik; homolog of rabbit KST1; hypothetical protein LOC539084; KST1; Na(+)/myo-inositol cotransporter 2; na+/myo-inositol cotransporter 2; Na+/myo-inositol cotransporter SMIT2; putative sodium-coupled cotransporter RKST1; R SGLT6; RGD:621410}; RKST1; RKST2; SGLT6; Slc5a10; slc5a11; slc5a11 {ECO:0000312; SLGTX; SMIT2; sodium/glucose cotransporter KST1; Sodium/myo-inositol cotransporter 2; sodium/myo-inositol transporter 2; sodium-cotransporter rkST1; sodium-coupled cotransporter KST1; sodium-dependent glucose cotransporter; sodium-glucose cotransporter-like protein; solute carrier family 5 (sodium/glucose cotransporter), member 10; solute carrier family 5 (sodium/glucose cotransporter), member 11; solute carrier family 5 (sodium/inositol cotransporter), member 11; solute carrier family 5 member 11; zgc:92080
Common Name SLC5A11
Gene Symbol SLC5A11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.