Invitrogen™ Human SLC5A10 (aa 538-567) Control Fragment Recombinant Protein

Product Code. 30210469

Brand: Invitrogen™ RP93356

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62532 (PA5-62532. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SGLT5 is a 62 kDa sodium/glucose cotransporter whose expression is restricted to kidney, and is thought to have a role in renal function. Multiple splicing transcripts exist.

Specifications

• Accession Number: A0PJK1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 125206
• Name: Human SLC5A10 (aa 538-567) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Na(+)/glucose cotransporter 5; SGLT5; SGLT-5; SLC5A10; Sodium/glucose cotransporter 5; solute carrier family 5 (sodium/glucose cotransporter), member 10; solute carrier family 5 (sodium/sugar cotransporter), member 10; solute carrier family 5 member 10
• Common Name: SLC5A10
• Gene Symbol: SLC5A10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PQSVQIENLTWWTLAQDVPLGTKAGDGQTP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining