Invitrogen™ Human SLC4A4 (aa 609-685) Control Fragment Recombinant Protein

Product Code. 30211248

Brand: Invitrogen™ RP96607

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57345 (PA5-57345. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Slc4a4 encodes a sodium bicarbonate cotransporter (NBC) involved in the regulation of bicarbonate secretion and absorption and intracellular pH. Slc4a4 is an electrogenic sodium/bicarbonate cotransporter with a Na(+):HCO3(-) stoichiometry varying from 1:2 to 1:3. Moreover, Slc4a4 may regulate bicarbonate influx/efflux at the basolateral membrane of cells and regulate intracellular pH. Isoform 2: May have a higher activity than isoform 1. Mutations in the Slc4a4 gene are associated with proximal renal tubular acidosis. Multiple transcript variants encoding different isoforms have been found for the Slc4a4 gene. Diseases associated with SLC4A4 include Renal Tubular Acidosis, Proximal, With Ocular Abnormalities and Proximal Renal Tubular Acidosis.

Specifications

• Accession Number: Q9Y6R1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8671
• Name: Human SLC4A4 (aa 609-685) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI835705; Electrogenic sodium bicarbonate cotransporter 1; electrogenic sodium bicarbonate cotransporter NBCe1 variant D; hhNMC; HNBC 1; HNBC1; KNBC; kNBC 1; kNBC1; Na(+)/HCO3(-) cotransporter; Na+HCO3- cotransporter 4; NBC; NBC 1; NBC 2; NBC1; NBC2; Nbc4; NBCE 1; NBCE1; NBCe1-A; NBC-like protein; OTTHUMP00000160355; OTTHUMP00000218884; OTTHUMP00000218885; pancreas sodium bicarbonate cotransporter; PNBC; Rnbc1; SLC4A4; SLC4A5; sodium bicarbonate cotransporter; sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney; sodium bicarbonate cotransporter, pancreas); solute carrier family 4 (anion exchanger), member 4; solute carrier family 4 (sodium bicarbonate cotransporter), member 4; solute carrier family 4 member 4; solute carrier family 4, member 4; solute carrier family 4, sodium bicarbonate cotransporter, member 4; solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type; solute carrier family 4, sodium bicarbonate cotransporter, member 5
• Common Name: SLC4A4
• Gene Symbol: SLC4A4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DYYPINSNFKVGYNTLFSCTCVPPDPANISISNDTTLAPEYLPTMSSTDMYHNTTFDWAFLSKKECSKYGGNLVGNN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining