Invitrogen™ Human SLC4A10 (aa 284-320) Control Fragment Recombinant Protein

Product Code. 30196448

Brand: Invitrogen™ RP109587

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140340 (PA5-140340. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the SLC4 bicarbonate transporter family are involved in solute transport and pH homeostasis. NCBE (SLC4A10) is a member of the SLC4 family of bicarbonate transporters, several of which play important roles in intracellular-pH regulation and transepithelial HCO(3)(-) transport. The SLC4A10 gene, which is highly expressed in the mammalian brain, contains two known alternative splicing units, inserts A and B. SLC4A10 encodes a sodium bicarbonate transporter with a brain-restricted expression pattern. Slc4a10 knockout (KO) mice have collapsed brain ventricles and display an increased seizure threshold, while heterozygous deletions in man have been associated with idiopathic epilepsy and other neurological symptoms. Slc4a10 is a promising pharmacological target for the therapy of epilepsy or elevated intracranial pressure.

Specifications

• Accession Number: Q6U841
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57282
• Name: Human SLC4A10 (aa 284-320) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: NBCN2; NCBE; Sodium-Driven Chloride Bicarbonate Exchanger
• Common Name: SLC4A10
• Gene Symbol: SLC4A10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSKGLGGQQKGHTSPCGMKQRHEKGPPHQQEREVDLH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining