Invitrogen™ Human SLC45A1 (aa 448-523) Control Fragment Recombinant Protein

Product Code. 30182370

Brand: Invitrogen™ RP99823

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140021. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene was isolated initially from a region on chromosome 1p that is frequently deleted in human neuroblastoma, although no causal relationship has since been demonstrated. The encoded protein belongs to the glycoside-pentoside-hexuronide cation symporter transporter family and may play a role in glucose uptake.

Specifications

• Accession Number: Q9Y2W3
• Concentration: 3.90 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 50651
• Name: Human SLC45A1 (aa 448-523) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: deleted in neuroblastoma 5 protein; DNB5; DNb-5; H+/sugar symporter; PAST-A; Proton-associated sugar transporter A; SLC45A1; Solute carrier family 45 member 1; solute carrier family 45, member 1
• Common Name: SLC45A1
• Gene Symbol: SLC45A1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QDRGLLEGREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQQVANILLNG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining