Invitrogen™ Human SLC44A4 (aa 156-224) Control Fragment Recombinant Protein

Product Code. 30181711

Brand: Invitrogen™ RP99592

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62934 (PA5-62934. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q53GD3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80736
• Name: Human SLC44A4 (aa 156-224) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C6orf29; choline transporter-like protein 4; CTL4; hTPPT1; NG22; SLC44A4; Solute carrier family 44 member 4; solute carrier family 44, member 4; testicular tissue protein Li 48; thiamine pyrophosphate transporter; Thiamine pyrophosphate transporter 1; TPPT; TPPT1; UNQ441/PRO874
• Common Name: SLC44A4
• Gene Symbol: SLC44A4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining