Invitrogen™ Human SLC43A2 (aa 538-569) Control Fragment Recombinant Protein

Product Code. 30193660

Brand: Invitrogen™ RP93382

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54451 (PA5-54451. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Uniporter that mediates the transport of the stereospecific L-phenylalanine, L-methionine and L-branched-chain amino acids, between the extracellular space and the cytoplasm and may control the transepithelial (re)absorption of neutral amino acid in kidney and small intestine. The transport activity is mediated through facilitated diffusion and is sodium ions-, chloride ions- and pH-independent.

Specifications

• Accession Number: Q8N370
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 124935
• Name: Human SLC43A2 (aa 538-569) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 7630402D21Rik; BC042513; large neutral amino acids transporter small subunit 4; Lat4; L-type amino acid transporter 4; L-type amino L-acid transporter 4; PP7664; Slc43a2; solute carrier family 43 (amino acid system L transporter), member 2; solute carrier family 43 member 2; solute carrier family 43, member 2
• Common Name: SLC43A2
• Gene Symbol: SLC43A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YRRQLERQLQQRQEDDKLFLKINGSSNQEAFV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining