Invitrogen™ Human SLC43A1 (aa 377-414) Control Fragment Recombinant Protein

Product Code. 30212833

Brand: Invitrogen™ RP92524

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53851 (PA5-53851. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids. SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.

Specifications

• Accession Number: O75387
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8501
• Name: Human SLC43A1 (aa 377-414) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610016F07Rik; AA986141; large neutral amino acids transporter small subunit 3; LAT3; L-type amino acid transporter 3; PB39; POV1; prostate cancer overexpressed gene 1; prostate cancer overexpressed gene 1 protein; R00504; Slc43a1; solute carrier family 43 (amino acid system L transporter), member 1; solute carrier family 43 member 1; solute carrier family 43, member 1
• Common Name: SLC43A1
• Gene Symbol: SLC43A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining