Invitrogen™ Human SLC41A3 (aa 1-62) Control Fragment Recombinant Protein

Product Code. 30197912

Brand: Invitrogen™ RP96307

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61106 (PA5-61106. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC41A3 (solute carrier family 41 member 3) is a 507 amino acid multi-pass membrane protein that belongs to the SLC41A transporter family that includes SLC41A1 and SLC41A2. Localizing to the cell membrane, SLC41A3 contains ten transmembrane domains and is believed to function as a plasma-membrane cation transporter. Its other two family members, SLC41A1 and SLC41A2, have been characterized to function as magnesium transporters and are essential for maintaining magnesium homeostasis within the cell.

Specifications

• Accession Number: Q96GZ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54946
• Name: Human SLC41A3 (aa 1-62) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: SLC41A1-L2; SLC41A1-like 2; SLC41A3; Solute carrier family 41 member 3; solute carrier family 41, member 3
• Common Name: SLC41A3
• Gene Symbol: SLC41A3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MDGTETRQRRLDSCGKPGELGLPHPLSTGGLPVASEDGALRAPESQSVTPKPLETEPSRETT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining