missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210665

Invitrogen™ Human SLC39A9 (aa 55-108) Control Fragment Recombinant Protein

Product Code. 30210665
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210665

Brand: Invitrogen™ RP108045

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111730 (PA5-111730. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The zinc transporter ZIP9, also known as SLC39A9, is a member of a family of divalent ion transporters. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. The zinc transporter family is divided into four subfamilies (I, II, LIV-1 and gufA). ZIP9 is a multipass membrane protein that belongs to the ZIP transporter subfamily I. It is located at the trans-Golgi network regardless of zinc presence and is thought to be a zinc homeostasis regulator acting in the secretory pathway without significantly altering cytosolic zinc homeostasis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NUM3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55334
Name Human SLC39A9 (aa 55-108) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010002A02Rik; 2610511I23Rik; 4833420E20Rik; AW209151; SLC39A9; solute carrier family 39 (zinc transporter), member 9; solute carrier family 39 member 9; solute carrier family 39, member 9; UNQ714/PRO1377; zinc transporter SLC39A9; zinc transporter ZIP9; ZIP9; ZIP-9; Zrt- and Irt-like protein 9
Common Name SLC39A9
Gene Symbol SLC39A9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.