missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210556

Invitrogen™ Human SLC39A8 (aa 220-292) Control Fragment Recombinant Protein

Product Code. 30210556
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210556

Brand: Invitrogen™ RP96670

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The zinc transporter ZIP8, also known as SLC39A9, is a member of a family of divalent ion transporters. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. The zinc transporter family is divided into four subfamilies (I, II, LIV-1 and gufA). ZIP8 is glycosylated and located at the plasma membrane and mitochondria. It has been identified as the transporter responsible for transport of the toxic Cadmium cation. ZIP8 has also been suggested to play a role in the regulation of interferon-gamma expression in activated human T cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9C0K1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64116
Name Human SLC39A8 (aa 220-292) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933419D20Rik; AA986696; BCG induced integral membrane protein BIGM103; BCG-induced integral membrane protein in monocyte clone 103 protein; BIGM103; CDG2N; LIV-1 subfamily of ZIP zinc transporter 6; LZT-Hs6; PP3105; Slc39a8; solute carrier family 39 (metal ion transporter), member 8; solute carrier family 39 (zinc transporter), member 8; solute carrier family 39 (zinc transporter), member 8 tv2; solute carrier family 39 member 8; Zinc transporter ZIP8; Zip8; ZIP-8; Zrt- and Irt-like protein 8
Common Name SLC39A8
Gene Symbol Slc39a8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.