Invitrogen™ Human SLC39A3 (aa 107-162) Control Fragment Recombinant Protein

Product Code. 30180892

Brand: Invitrogen™ RP99128

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59886 (PA5-59886. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The zinc transporter ZIP3, also known as SLC39A3, is a member of a family of divalent ion transporters. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. Similar to knock-outs of ZIP1 and ZIP2, ZIP3-null mice have no phenotypic differences compared to wild-type mice. Only when ZIP1, ZIP2, and ZIP3 genes are all eliminated and these mutant mice are fed a zinc-deficient diet do abnormalities such as reduced embryonic-membrane bound alkaline phosphatase activity and abnormal development occur, indicating that the ZIP1-3 proteins play an important, noncompensatory role when zinc is deficient. More recent studies have shown that ZIP2 and ZIP3 are down regulated in human prostate adenocarcinomatous glands, and may be important in the retention of zinc in the cellular compartment.

Specifications

• Accession Number: Q9BRY0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29985
• Name: Human SLC39A3 (aa 107-162) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI845814; SLC39A3; solute carrier family 39 (zinc transporter), member 3; solute carrier family 39 member 3; Zinc transporter ZIP3; Zip3; ZIP-3; Zrt- and Irt-like protein 3
• Common Name: SLC39A3
• Gene Symbol: SLC39A3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining