missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181721

Invitrogen™ Human SLC38A1 (aa 5-70) Control Fragment Recombinant Protein

Product Code. 30181721
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181721

Brand: Invitrogen™ RP97695

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62580 (PA5-62580. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H2H9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81539
Name Human SLC38A1 (aa 5-70) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA408026; AA409865; AL022800; Amino acid transporter A1; amino acid transporter system A1; ATA1; AU015942; GlnT; glutamine transporter; MNat2; Nat2; N-system amino acid transporter 2; rATA1; S38A1; Sa2; SAT1; SLC38A1; SNAT 1; Snat1; sodium-coupled neutral amino acid transporter 1; Solute carrier family 38 member 1; solute carrier family 38, member 1; system A amino acid transporter 1; System A transporter 2; system N amino acid transporter 1
Common Name SLC38A1
Gene Symbol SLC38A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.