Invitrogen™ Human SLC37A4 (aa 189-219) Control Fragment Recombinant Protein

Artikelnummer. 30209573

missing translation for 'mfr': Invitrogen™ RP95794

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58600 (PA5-58600. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.

Spezifikation

• Accession Number: O43826
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2542
• Name: Human SLC37A4 (aa 189-219) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: G6PT; G6PT1; G6PT2; G6PT3; glucose 6-phosphate transporter; glucose-5-phosphate transporter; glucose-6-phosphatase transport protein 1; glucose-6-phosphatase, transport (glucose) protein 3; glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1; glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2; glucose-6-phosphatase, transport protein 1; glucose-6-phosphate exchanger SLC37A4; Glucose-6-phosphate translocase; GSD1b; GSD-1 b; GSD1c; GSD1d; mG6PT; MGC15729; microsomal glucose-6-phosphate transporter; PRO0685; SLC37A4; solute carrier family 37 (glucose-6-phosphate transporter), member 4; solute carrier family 37 (glycerol-6-phosphate transporter), member 4; solute carrier family 37 member 4; Transformation-related gene 19 protein; transporter; TRG19; TRG-19; Unknown (protein for MGC:137413)
• Common Name: SLC37A4
• Gene Symbol: Slc37a4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NEPADVGLRNLDPMPSEGKKGSLKEESTLQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining