missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLC37A4 (aa 189-219) Control Fragment Recombinant Protein

Artikelnummer. 30209573
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30209573

missing translation for 'mfr': Invitrogen™ RP95794

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58600 (PA5-58600. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number O43826
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2542
Name Human SLC37A4 (aa 189-219) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias G6PT; G6PT1; G6PT2; G6PT3; glucose 6-phosphate transporter; glucose-5-phosphate transporter; glucose-6-phosphatase transport protein 1; glucose-6-phosphatase, transport (glucose) protein 3; glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1; glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2; glucose-6-phosphatase, transport protein 1; glucose-6-phosphate exchanger SLC37A4; Glucose-6-phosphate translocase; GSD1b; GSD-1 b; GSD1c; GSD1d; mG6PT; MGC15729; microsomal glucose-6-phosphate transporter; PRO0685; SLC37A4; solute carrier family 37 (glucose-6-phosphate transporter), member 4; solute carrier family 37 (glycerol-6-phosphate transporter), member 4; solute carrier family 37 member 4; Transformation-related gene 19 protein; transporter; TRG19; TRG-19; Unknown (protein for MGC:137413)
Common Name SLC37A4
Gene Symbol Slc37a4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NEPADVGLRNLDPMPSEGKKGSLKEESTLQE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt