Invitrogen™ Human SLC37A1 (aa 44-95) Control Fragment Recombinant Protein

Product Code. 30209253

Brand: Invitrogen™ RP95891

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56468 (PA5-56468. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.

Specifications

• Accession Number: P57057
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54020
• Name: Human SLC37A1 (aa 44-95) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FLJ22340; G-3-P permease; G-3-P transporter; G3PP; Glucose-6-phosphate exchanger SLC37A1; glycerol-3-phosphate permease; glycerol-3-phosphate transporter; Slc37a1; solute carrier family 37 (glucose-6-phosphate transporter), member 1; solute carrier family 37 (glycerol-3-phosphate transporter), member 1; solute carrier family 37 member 1
• Common Name: SLC37A1
• Gene Symbol: SLC37A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining