Invitrogen™ Human SLC35F5 (aa 125-219) Control Fragment Recombinant Protein

Product Code. 30197672

Brand: Invitrogen™ RP95998

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57076 (PA5-57076. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC35F5 is a putative solute transporter.

Specifications

• Accession Number: Q8WV83
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80255
• Name: Human SLC35F5 (aa 125-219) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300003P13Rik; AI646727; HCV NS5A-transactivated protein 3; hepatitis C virus NS5A-transactivated protein 3; NS5ATP3; SLC35F5; Solute carrier family 35 member F5; solute carrier family 35, member F5; UNQ2545/PRO6097
• Common Name: SLC35F5
• Gene Symbol: SLC35F5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RQQCTRGLRGKHAAFFADAEGYFAACTTDTTMNSSLSEPLYVPVKFHDLPSEKPESTNIDTEKTPKKSRVRFSNIMEIRQLPSSHALEAKLSRMS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining