Invitrogen™ Human SLC35B1 (aa 106-137) Control Fragment Recombinant Protein

Product Code. 30209620

Brand: Invitrogen™ RP100118

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65523 (PA5-65523, PA5-63439 (PA5-63439. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.

Specifications

• Accession Number: P78383
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10237
• Name: Human SLC35B1 (aa 106-137) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Endoplasmic reticulum nucleotide sugar transporter 1; ERNST; galactose transporter; hUGTrel1; putative endoplasmic reticulum nucleotide sugar transporter; Slc35b1; Solute carrier family 35 member B1; solute carrier family 35 member B1-like protein; solute carrier family 35, member B1; UDP-galactose translocator 2; UDP-galactose transporter related; UDP-galactose transporter-related protein 1; Ugalt2; UGALT2 protein; UGTREL1; wu:fj99g11; zgc:92284
• Common Name: SLC35B1
• Gene Symbol: SLC35B1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining