Invitrogen™ Human SLC34A3 (aa 1-78) Control Fragment Recombinant Protein

Product Code. 30207549

Brand: Invitrogen™ RP93101

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54883 (PA5-54883. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of SLC34A transporter family of proteins, and is expressed primarily in the kidney. It is involved in transporting phosphate into cells via sodium cotransport in the renal brush border membrane, and contributes to the maintenance of inorganic phosphate concentration in the kidney. Mutations in this gene are associated with hereditary hypophosphatemic rickets with hypercalciuria. Alternatively spliced transcript variants varying in the 5' UTR have been found for this gene.

Specifications

• Accession Number: Q8N130
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 142680
• Name: Human SLC34A3 (aa 1-78) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI649385; HHRH; Na(+)/Pi cotransporter 2 C; Na(+)-dependent phosphate cotransporter 2 C; Na+/Pi-cotransporter type IIc; naPi-2 c; Npt2c; Npt2c-v1; NptIIc; Slc34a3; Sodium/inorganic phosphate cotransporter IIC; sodium/phosphate cotransporter 2 C; Sodium-dependent phosphate transport protein 2 C; sodium-dependent phosphate transport protein 2 C; LOW QUALITY PROTEIN: sodium-dependent phosphate transport protein 2 C; sodium-phosphate cotransporter IIC; sodium-phosphate transport protein 2 C; solute carrier family 34 (sodium phosphate), member 3; solute carrier family 34 (type II sodium/phosphate contransporter), member 3; solute carrier family 34 (type II sodium/phosphate cotransporter), member 3; solute carrier family 34 member 3; type IIc Na+/Pi cotransporter; type IIc Na+/Pi-cotransporter; type IIc NaPi-cotransporter-v1
• Common Name: SLC34A3
• Gene Symbol: SLC34A3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVAGSVLKACG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining