Invitrogen™ Human SLC34A1 (aa 276-346) Control Fragment Recombinant Protein

Product Code. 30212113

Brand: Invitrogen™ RP109617

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Renal tubular reabsorption of phosphate is critical to the maintenance of phosphate homeostasis in mammals. The brush-border membrane Na+/Pi cotransport systems in proximal tubules play a major role in this process. The renal Na(+)/P(i) cotransporter NPT2 is expressed in the brush border membrane (BBM) of proximal tubular cells. NPT2 gene expression is crucial for PTH effects on renal P(i) handling. However, renal expression of the sodium/phosphate cotransporter gene, NPT2, is not required for regulation of renal 1 alpha-hydroxylase by phosphate. NPT2 is an integral membrane protein expressed in kidney and lung. The gene encoding human NPT1 maps to chromosome 6q21.3-p23, while the gene encoding human NPT2 maps to chromosome 5q35.

Specifications

• Accession Number: Q06495
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6569
• Name: Human SLC34A1 (aa 276-346) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FRTS2; HCINF2; Na(+)/Pi cotransporter 2 A; Na(+)-dependent phosphate cotransporter 2 A; Na/Pi cotransporter; Na+-phosphate cotransporter type II; NaPi-2; NaPi2A; naPi-2 A; NAPI-3; naPi-7; NaPi-IIa; NPHLOP1; NPT2; Npt2a; NPTIIa; renal Na+/Pi transporter; renal sodium-dependent phosphate transporter; SLC11; Slc17a2; Slc34a1; sodium/phosphate co-transporter; sodium/phosphate cotransporter 2 A; Sodium-dependent phosphate transport protein 2 A; sodium-phosphate transport protein 2 A; solute carrier family 17 (sodium phosphate), member 2; solute carrier family 17 (sodium/hydrogen exchanger) member 2; solute carrier family 17 (sodium/hydrogen exchanger), member 2; solute carrier family 34 (sodium phosphate), member 1; solute carrier family 34 (type II sodium/phosphate cotransporter), member 1; solute carrier family 34 member 1; solute carrier family 34, member 1; type IIa Na+/Pi-cotransporter
• Common Name: SLC34A1
• Gene Symbol: SLC34A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining