Invitrogen™ Human SLC30A1 (aa 136-248) Control Fragment Recombinant Protein

Product Code. 30193559

Brand: Invitrogen™ RP91274

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82524 (PA5-82524. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc, an essential element required for cell proliferation and differentiation, plays a role in a diverse array of cellular functions, including acting as a cofactor for numerous enzymes and transcription factors and as a neuroregulator. The zinc transporter (ZnT) family regulates the supply of zinc within cells, and its members are characterized by containing six membrane-spanning domains, a large histidine-rich intracellular loop, and a C-terminal tail. ZnT-1, a ubiquitous protein of approximately 60 kDa, localizes to the plasma membrane to aid in the export of zinc out of cells.

Specifications

• Accession Number: Q9Y6M5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7779
• Name: Human SLC30A1 (aa 136-248) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI839647; C130040I11Rik; Slc30a1; solute carrier family 30 (zinc transporter), member 1; solute carrier family 30 member 1; solute carrier family 30, member 1; zinc transporter 1; ZNT1; ZnT-1; ZnT-1 zinc transporter; ZRC1
• Common Name: SLC30A1
• Gene Symbol: Slc30a1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPGEQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRAGQLNMRGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining