Invitrogen™ Human SLC29A3 (aa 75-104) Control Fragment Recombinant Protein

Product Code. 30201235

Brand: Invitrogen™ RP105085

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66109 (PA5-66109. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC29A3 is a member of the equilibrative nucleoside transporter family which plays a key role in nucleoside and nucleobase uptake for salvage pathways of nucleotide synthesis. SLC29A3 is a transmembrane glycoprotein that localizes to the lysosomal membrane and is a broad selectivity, low affinity nucleoside transporter. Mutations in the SLC29A3 gene have been associated with H syndrome, which is characterized by cutaneous hyperpigmentation and hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism. A related disorder, PHID (pigmented hypertrichosis with insulin-dependent diabetes mellitus), has also been associated with mutations at this locus.

Specifications

• Accession Number: Q9BZD2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55315
• Name: Human SLC29A3 (aa 75-104) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933435C21Rik; AW987637; Ent3; Equilibrative nucleoside transporter 3; HCLAP; hENT3; HJCD; mENT3; PHID; Slc29a3; solute carrier family 29 (equilibrative nucleoside transporter), member 3; solute carrier family 29 (nucleoside transporters), member 3; solute carrier family 29 member 3; UNQ717/PRO1380
• Common Name: SLC29A3
• Gene Symbol: SLC29A3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEYWMFKLRNSSSPATGEDPEGSDILNYFE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining