Invitrogen™ Human SLC28A2 (aa 590-658) Control Fragment Recombinant Protein

Product Code. 30205006

Brand: Invitrogen™ RP103224

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63151 (PA5-63151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The concentrative nucleoside transporter (CNT) family comprises three members: CNT1, CNT2 and CNT3. CNT2 participates in the absorption and disposition of endogenous nucleosides and mediates the first step of nucleotide biosynthesis. CNT2 levels are highly dependent on insulin (but not glucose) concentration, and the protein is under the control of the Adenosine 1 receptor. CNT family members are imperative in the response of cells to a variety of anticancer and antiviral nucleoside analogs, as the CNT proteins modulate their entry into target tissues. Increasing evidence also suggests that CNT2 may have a role in energy metabolism because activation of CNT2 relies on the opening of ATP-sensitive K+ channels.

Specifications

• Accession Number: O43868
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9153
• Name: Human SLC28A2 (aa 590-658) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010208B10Rik; B430217P18; BB152493; CNT 2; CNT2; CNT-2; Concentrative nucleoside transporter 2; HCNT2; HsT17153; Na(+)/nucleoside cotransporter 2; purine-selective Na+ nucleoside cotransporter; rCNT2; Slc28a2; sodium/nucleoside cotransporter 2; sodium/purine nucleoside cotransporter; Sodium/purine nucleoside co-transporter; Sodium-coupled nucleoside transporter 2; solute carrier family 28 (concentrative nucleoside transporter), member 2; solute carrier family 28 (sodium-coupled nucleoside transporter), member 2; solute carrier family 28 member 2; solute carrier family 28, member 2; SPNT; SPNT1
• Common Name: SLC28A2
• Gene Symbol: SLC28A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining