Invitrogen™ Human SLC26A6 (aa 547-634) Control Fragment Recombinant Protein

Product Code. 30209094

Brand: Invitrogen™ RP100585

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61722 (PA5-61722. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the solute carrier 26 family, whose members encode anion transporter proteins. This particular family member encodes a protein involved in transporting chloride, oxalate, sulfate and bicarbonate. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Specifications

• Accession Number: Q9BXS9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 65010
• Name: Human SLC26A6 (aa 547-634) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: anion exchange transporter; anion transporter 1; B930010B04Rik; CFEX; Chloride-formate exchanger; DKFZp586E1422; Pat1; Pat-1; pendrin L1; pendrin-L1; Pendrin-like protein 1; putative anion transporter-1; SLC26A6; solute carrier family 26 (anion exchanger), member 6; solute carrier family 26 member 6; solute carrier family 26, member 6; sulfate anion transporter
• Common Name: SLC26A6
• Gene Symbol: SLC26A6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQAASPKGASVSINVNTSLEDMRSNNVEDCKMMQVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining