Invitrogen™ Human SLC26A11 (aa 467-536) Control Fragment Recombinant Protein

Product Code. 30194673

Brand: Invitrogen™ RP93475

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56286 (PA5-56286. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q86WA9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284129
• Name: Human SLC26A11 (aa 467-536) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: anion exchanger Slc26a11; F630021I08Rik; novel sulfate transporter protein (Slc26a11); slc26a11; Sodium-independent sulfate anion transporter; solute carrier family 26 (anion exchanger), member 11; solute carrier family 26 member 11; solute carrier family 26, member 11
• Common Name: SLC26A11
• Gene Symbol: SLC26A11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining