Invitrogen™ Human SLC25A24 (aa 1-75) Control Fragment Recombinant Protein

Product Code. 30209899

Brand: Invitrogen™ RP105264

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66609 (PA5-66609. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.

Specifications

• Accession Number: Q6NUK1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29957
• Name: Human SLC25A24 (aa 1-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610016M12Rik; APC1; Calcium-binding mitochondrial carrier protein SCaMC-1; calcium-binding mitochondrial carrier protein SCaMC-1-like; Calcium-binding mitochondrial carrier protein SCaMC-1-like protein; calcium-binding transporter; DKFZp586G0123; EFINAL; MCSC1; Mitochondrial ATP-Mg/Pi carrier protein 1; mitochondrial Ca(2+)-dependent solute carrier protein 1; Peroxisomal Ca(2+)-dependent solute carrier; peroxisomal Ca-dependent solute carrier; RP11-356N1.3; scamc1; SCAMC-1; short calcium-binding mitochondrial carrier 1; si:ch211-63o20.9; similar to mitochondrial solute carrier; Slc25a24; Small calcium-binding mitochondrial carrier protein 1; solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24; solute carrier family 25 member 24; zgc:92470
• Common Name: SLC25A24
• Gene Symbol: SLC25A24
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining