missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199263

Invitrogen™ Human SLC25A23 (aa 20-147) Control Fragment Recombinant Protein

Product Code. 30199263
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199263

Brand: Invitrogen™ RP105717

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64930 (PA5-64930. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane (PubMed:15123600). May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria (PubMed:15123600). Acts as a regulator of mitochondrial calcium uptake via interaction with MCU and MICU1 (PubMed:24430870). [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BV35
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79085
Name Human SLC25A23 (aa 20-147) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310067G05Rik; APC2; calcium-binding mitochondrial carrier protein SCaMC-3; MCSC2; mitochondrial ATP-Mg/Pi carrier protein 2; Mitochondrial Ca(2+)-dependent solute carrier protein 2; mitochondrial Ca2+-dependent solute carrier protein 2; phosphate carrier), member 23; SCAMC3; SCaMC-3; short calcium-binding mitochondrial carrier 3; Slc25a23; sma; Small calcium-binding mitochondrial carrier protein 3; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23; solute carrier family 25 member 23
Common Name SLC25A23
Gene Symbol SLC25A23
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.