Invitrogen™ Human SLC25A22 (aa 58-161) Control Fragment Recombinant Protein

Product Code. 30200089

Brand: Invitrogen™ RP90492

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53207 (PA5-53207. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SLC25 gene family encodes mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane (Palmieri, 2004 ). SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18.

Specifications

• Accession Number: Q9H936
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79751
• Name: Human SLC25A22 (aa 58-161) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300006L01Rik; AI060884; EIEE3; FLJ13044; GC1; GC-1; Glutamate/H(+) symporter 1; mitochondrial glutamate carrier 1; NET44; RGD1307826; Slc25a22; solute carrier family 25 (mitochondrial carrier, glutamate), member 22; solute carrier family 25 (mitochondrial carrier: glutamate), member 22; solute carrier family 25 member 22
• Common Name: SLC25A22
• Gene Symbol: Slc25a22
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining