missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195666

Invitrogen™ Human SLC25A17 (aa 32-66) Control Fragment Recombinant Protein

Product Code. 30195666
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195666

Brand: Invitrogen™ RP91536

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84124 (PA5-84124. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43808
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10478
Name Human SLC25A17 (aa 32-66) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 34 kDa peroxisomal membrane protein; 34 kDa; 47 kDa; peroxisomal integral membrane protein 47; peroxisomal membrane protein PMP34; peroxisomal membrane protein, 34 kDa; Pmp34; Pmp35; Pmp47; SLC25A17; solute carrier family 25 (mitochondrial carrier, peroxisomal membrane protein), member 17; solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34 kDa), member 17; solute carrier family 25 member 17; solute carrier family 25, member 17
Common Name SLC25A17
Gene Symbol SLC25A17
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.