missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200767

Invitrogen™ Human SLC25A12 (aa 126-187) Control Fragment Recombinant Protein

Product Code. 30200767
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200767

Brand: Invitrogen™ RP95789

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57233 (PA5-57233. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in the gene encoding this protein may be associated with risk of autism.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75746
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8604
Name Human SLC25A12 (aa 126-187) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610002D09Rik; AGC1; AI839531; araceli hiperlarga; ARALAR; Aralar1; B230107K20Rik; BB129864; calcium binding mitochondrial carrier superfamily member Aralar1; calcium-binding mitochondrial carrier protein Aralar1; Calcium-binding mitochondrial carrier protein Aralar1-like protein; mitochondrial aspartate glutamate carrier 1; RGD1561141; SLC25A12; solute carrier family 25 (aspartate/glutamate carrier), member 12; solute carrier family 25 (mitochondrial carrier, Aralar), member 12; solute carrier family 25 member 12; solute carrier family 25, member 12
Common Name SLC25A12
Gene Symbol SLC25A12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.