missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLC22A13 (aa 500-550) Control Fragment Recombinant Protein

Product Code. 30194859
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194859

Brand: Invitrogen™ RP96458

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57336 (PA5-57336. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y226
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9390
Name Human SLC22A13 (aa 500-550) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI648912; OAT10; OCTL1; OCTL3; ORCTL3; ORCTL-3; Organic cation transporter-like 3; organic cationic transporter-like 3; organic-cation transporter like 3; Slc22a13; solute carrier family 22 (organic anion transporter), member 13; solute carrier family 22 (organic anion/urate transporter), member 13; solute carrier family 22 (organic cation transporter), member 13; solute carrier family 22 member 13; solute carrier family 22, member 13
Common Name SLC22A13
Gene Symbol SLC22A13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSSTY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.