Invitrogen™ Human SLC18A1 (aa 484-525) Control Fragment Recombinant Protein

Product Code. 30199158

Brand: Invitrogen™ RP107286

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66633 (PA5-66633. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC18A1 (Solute Carrier Family 18 Member A1) is a Protein Coding gene. Diseases associated with SLC18A1 include Barbiturate Abuse and Adrenal Neuroblastoma. Among its related pathways are Transport of inorganic cations/anions and amino acids/oligopeptides and Synaptic vesicle pathway. Gene Ontology (GO) annotations related to this gene include monoamine transmembrane transporter activity and xenobiotic transmembrane transporter activity. An important paralog of this gene is SLC18A2.

Specifications

• Accession Number: P54219
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6570
• Name: Human SLC18A1 (aa 484-525) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CGAT; VMAT
• Common Name: SLC18A1
• Gene Symbol: SLC18A1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining