Invitrogen™ Human SLC16A2 (aa 499-539) Control Fragment Recombinant Protein

Product Code. 30196606

Brand: Invitrogen™ RP107895

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67259 (PA5-67259. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Monocarboxylates, such as lactate and pyruvate, play an integral role in cellular metabolism. Lactic acid is produced in large quantities as a result of glycolysis, which provides the majority of ATP to cells under normal physiological conditions. However, accumulation of lactic acid leads to a decrease in intracellular pH and cessation of glycolysis. In order for glycolysis to continue at a high rate, lactic acid must be transported out of the cell. This transport process is carried out by a family of monocarboxylate transporters (MCTs), which function as proton symports and are stereoselective for L-lactate. The MCT family consists of at least eight members, MCT 1-8, which contain between 10-12 transmembrane-helical (TM) domains, with the amino and carboxy termini located in the cytoplasm. Defects in the gene encoding for MCT8, SLC16A2, can cause monocarboxylate transporter 8 deficiency (MCT8 deficiency), a defect in cellular hormone transport causing a severe form of X-linked psychomotor retardation and abnormal thyroid levels.

Specifications

• Accession Number: P36021
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6567
• Name: Human SLC16A2 (aa 499-539) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AHDS; AW105741; DXS128; DXS128E; MCT 7; MCT 8; MCT7; MCT8; monocarboxylate transporter; monocarboxylate transporter 7; Monocarboxylate transporter 8; Monocarboxylate transporter 8 (MCT 8) (X-linked PEST-containing transporter); MR x 22; SLC16A2; solute carrier family 16 (monocarboxylic acid transporters), member 2; solute carrier family 16 member 2; solute carrier family 16, member 2 (monocarboxylic acid transporter 8); solute carrier family 16, member 2 (thyroid hormone transporter); X-linked PEST-containing transporter; XPCT
• Common Name: SLC16A2
• Gene Symbol: Slc16a2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining