Invitrogen™ Human SLC13A5 (aa 372-408) Control Fragment Recombinant Protein

Product Code. 30199667

Brand: Invitrogen™ RP93293

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60679 (PA5-60679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

S13A5 is a tricarboxylate plasma transporter with a preference for citrate.

Specifications

• Accession Number: Q86YT5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284111
• Name: Human SLC13A5 (aa 372-408) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EIEE25; Indy; mINDY; Na(+)/citrate cotransporter; Na+-coupled citrate transporter protein; NaC2/NaCT; NACT; novel solute carrier family 13 (sodium-dependent dicarboxylate transporter) (Slc13a2 or 3) member; SLC13A5; Sodium-coupled citrate transporter; sodium-dependent citrate transporter; sodium-dependent dicarboxylate transporter; solute carrier family 13 (sodium-dependent citrate transporter), member 5; solute carrier family 13 member 5
• Common Name: SLC13A5
• Gene Symbol: SLC13A5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining