missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208222

Invitrogen™ Human SLC13A3 (aa 404-463) Control Fragment Recombinant Protein

Product Code. 30208222
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208222

Brand: Invitrogen™ RP91164

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-110789 (PA5-110789, PA5-53151 (PA5-53151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WWT9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64849
Name Human SLC13A3 (aa 404-463) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias hNaDC3; hypothetical protein zgc:77173; mNaDC3; Na(+)/dicarboxylate cotransporter 3; Nadc3; NaDC-3; rNaDC3; SDCT2; slc13a3; sodium-dependent high affinity dicarboxylate transporter 3; sodium-dependent high-affinity dicarboxylate transporter 2; sodium-dependent high-affinity dicarboxylate transporter 3; solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3; solute carrier family 13 member 3; zgc:77173
Common Name SLC13A3
Gene Symbol SLC13A3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.