Invitrogen™ Human SLC10A2 (aa 318-347) Control Fragment Recombinant Protein

Product Code. 30197202

Brand: Invitrogen™ RP101763

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52108 (PA5-52108. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a sodium/bile acid cotransporter. This transporter is the primary mechanism for uptake of intestinal bile acids by apical cells in the distal ileum. Bile acids are the catabolic product of cholesterol metabolism, so this protein is also critical for cholesterol homeostasis. Mutations in this gene cause primary bile acid malabsorption (PBAM); mutations in this gene may also be associated with other diseases of the liver and intestines, such as familial hypertriglyceridemia (FHTG).

Specifications

• Accession Number: Q12908
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6555
• Name: Human SLC10A2 (aa 318-347) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Apical sodium-dependent bile acid transporter; ASBT; IBAT; ileal apical sodium-dependent bile acid transporter; ileal Na(+)/bile acid cotransporter; ileal sodium/bile acid cotransporter; Ileal sodium-dependent bile acid transporter; ISBAT; ISBT; Na(+)-dependent ileal bile acid transporter; NTCP2; PBAM; Slc10a2; Sodium/taurocholate cotransporting polypeptide, ileal; sodium/taurocholate-cotransporting polypeptide, ileal; solute carrier family 10 (sodium/bile acid cotransporter family), member 2; solute carrier family 10 (sodium/bile acid cotransporter), member 2; solute carrier family 10 member 2; solute carrier family 10, member 2
• Common Name: SLC10A2
• Gene Symbol: Slc10a2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NKAEIPESKENGTEPESSFYKANGGFQPDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining