Invitrogen™ Human SKP2 (aa 130-212) Control Fragment Recombinant Protein

Product Code. 30197944

Brand: Invitrogen™ RP104022

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Skp2 (S-phase Kinase-associated Protein 2) belongs to the family of F-box proteins that interact with the Cyclin A-Cdk2 complex. Skp2 is essential for the G1-S transition in both transformed cells and diploid fibroblasts. Biochemical and genetic experiments have demonstrated that Skp2 is required for the ubiquitination and consequent degradation of p27 in cultured mammalian cells and in vitro reconstitution assays. In normal tissues, Skp2 is expressed in tonsil and placenta. In tumor tissues, Skp2 is expressed widely, in some colon, prostate, pancreas, and skin cancers, with high expression in lung, breast, ovarian, and endometrial cancers. Research suggests that Skp2 plays a role in oncogenesis, particularly in the pathogenesis of lymphomas and breast cancers.

Specifications

• Accession Number: Q13309
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6502
• Name: Human SKP2 (aa 130-212) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930500A04Rik; CDK2/cyclin A-associated protein p45; cyclin A/CDK2-associated protein p45; Cyclin-A/CDK2-associated protein p45; FBL1; F-box protein Skp2; F-box/LRR-repeat protein 1; F-box/WD-40 protein 1; FBXL1; FLB1; FWD1; MGC1366; OTTHUMP00000221389; p45; p45skp2; RGD1562456; Skp2; S-phase kinase-associated protein 2; S-phase kinase-associated protein 2 (p45); S-phase kinase-associated protein 2, E3 ubiquitin protein ligase
• Common Name: SKP2
• Gene Symbol: SKP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining