Invitrogen™ Human SKP1 (aa 80-163) Control Fragment Recombinant Protein

Product Code. 30200899

Brand: Invitrogen™ RP104976

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111377 (PA5-111377. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteasome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7.

Specifications

• Accession Number: P63208
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6500
• Name: Human SKP1 (aa 80-163) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 15 kDa; 2610043E24Rik; 2610206H23Rik; cyclin A/CDK2-associated p19; cyclin A/CDK2-associated protein p19; cyclin-A/CDK2-associated protein p19; EMC19; MGC34403; OCP2; OCP-2; OCP-II; OCP-II protein; organ of Corti protein 2; Organ of Corti protein II; p19A; p19Skp1; polypeptide 1-like; RNA polymerase II elongation factor-like protein; RNA polymerase II elongation factor-like protein OCP2; SIII; Skp1; Skp1a; S-phase kinase-associated protein 1; S-phase kinase-associated protein 1 A; TCEB1L; transcription elongation factor B polypeptide 1-like
• Common Name: SKP1
• Gene Symbol: SKP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining