Invitrogen™ Human SKOR2 (aa 1-53) Control Fragment Recombinant Protein

Product Code. 30181750

Brand: Invitrogen™ RP98298

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61186 (PA5-61186. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Exhibits transcriptional repressor activity. Acts as a TGF-beta antagonist in the nervous system.

Specifications

• Accession Number: Q2VWA4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 652991
• Name: Human SKOR2 (aa 1-53) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CH18515; Corl2; EG664805; functional smad suppressing element 18; functional Smad suppressor element on chromosome 18; functional Smad-suppressing element on chromosome 18; FUSSEL18; Fussel-18; fussel-18 homolog; Gm7348; ladybird homeobox corepressor 1-like protein; LB x 1 corepressor 1-like protein; SKI family transcriptional corepressor 2; Skor2; Transcriptional corepressor Corl2
• Common Name: SKOR2
• Gene Symbol: SKOR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining