Invitrogen™ Human SKOR1 (aa 688-759) Control Fragment Recombinant Protein

Product Code. 30202602

Brand: Invitrogen™ RP109249

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139977 (PA5-139977. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SKOR1 acts as a transcriptional corepressor of LBX1. Inhibits BMP signaling.

Specifications

• Accession Number: P84550
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 390598
• Name: Human SKOR1 (aa 688-759) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV273001; C230094B15Rik; corepressor for LB x 1; CORL1; functional smad suppressing element 15; functional Smad-suppressing element on chromosome 15; FUSSEL15; fussel-15; fussel-15 homolog; ladybird homeobox 1 homolog corepressor 1; ladybird homeobox corepressor 1; ladybird homeobox corepressor 1; LOW QUALITY PROTEIN: SKI family transcriptional corepressor 1; LB x 1 corepressor 1; Lbxcor1; Lbxcor1 homolog; RGD1307687; SKI family transcriptional corepressor 1; Skor1; Transcriptional corepressor Corl1
• Common Name: SKOR1
• Gene Symbol: SKOR1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GPDGEQPTGPPSATSSGADGPANSPDGGSPRPRRRLGPPPAGRPAFGDLAAEDLVRRPERSPPSGGGGYELR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining