Invitrogen™ Human SKIV2L (aa 493-571) Control Fragment Recombinant Protein

Product Code. 30182427

Brand: Invitrogen™ RP99551

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-140068 (PA5-140068, PA5-62966 (PA5-62966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a human homologue of yeast SKI2 and may be involved in antiviral activity by blocking translation of poly(A) deficient mRNAs. This gene is located in the class III region of the major histocompatibility complex.

Specifications

• Accession Number: Q15477
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6499
• Name: Human SKIV2L (aa 493-571) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 170 A; 4930534J06Rik; AW214248; Dd x 13; Helicase SKI2W; helicase-like protein; HLP; SKI; SKI2; SKI2 homolog, superkiller viralicidic activity 2-like; Ski2 like RNA helicase; Ski2w; SKIV2; SKIV2L; SKIV2L1; superkiller viralicidic activity 2-like; superkiller viralicidic activity 2-like (S. cerevisiae); THES2; W
• Common Name: SKIV2L
• Gene Symbol: SKIV2L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining