Invitrogen™ Human SKAP55 (aa 214-320) Control Fragment Recombinant Protein

Product Code. 30200487

Brand: Invitrogen™ RP102128

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110663 (PA5-110663. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.

Specifications

• Accession Number: Q86WV1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8631
• Name: Human SKAP55 (aa 214-320) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700091G21Rik; epididymis secretory sperm binding protein Li 81 p; HEL-S-81 p; ortholog of human src family associated phosphoprotein 1 SCAP1; pp55; SCAP1; Skap1; Skap55; Skap-55; SKAP55 adapter protein; SKAP55 adaptor protein; src family associated phosphoprotein 1; src family-associated phosphoprotein 1; src kinase associated phosphoprotein 1; src kinase-associated phosphoprotein 1; Src kinase-associated phosphoprotein of 55 kDa
• Common Name: SKAP55
• Gene Symbol: SKAP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining