missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SKAP55 (aa 214-320) Control Fragment Recombinant Protein

Product Code. 30200487
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200487

Brand: Invitrogen™ RP102128

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110663 (PA5-110663. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86WV1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8631
Name Human SKAP55 (aa 214-320) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700091G21Rik; epididymis secretory sperm binding protein Li 81 p; HEL-S-81 p; ortholog of human src family associated phosphoprotein 1 SCAP1; pp55; SCAP1; Skap1; Skap55; Skap-55; SKAP55 adapter protein; SKAP55 adaptor protein; src family associated phosphoprotein 1; src family-associated phosphoprotein 1; src kinase associated phosphoprotein 1; src kinase-associated phosphoprotein 1; Src kinase-associated phosphoprotein of 55 kDa
Common Name SKAP55
Gene Symbol SKAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.