Invitrogen™ Human SKA3 (aa 327-412) Control Fragment Recombinant Protein

Product Code. 30198323

Brand: Invitrogen™ RP109000

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139853 (PA5-139853. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Upon entry into mitosis, the cell's microtubule (MT) network forms the mitotic spindle, allowing the segregation of paired chromosomes. Proteinaceous structures on centromeric chromatin termed kinetochores (KT) are essential for the proper attachment of the chromosomes to the spindle MTs. A recently discovered spindle and kinetochore complex, comprised of proteins SKA1, SKA2, and SKA3, has been found to be required for stable KT-MT interactions and timely anaphase onset. Like with SKA1 or SKA2, depletion of SKA3 by siRNA delays anaphase transition, resulting in a prolonged a metaphase-like state. These SKA3-depleted cells accumulate high levels of the checkpoint protein Bub1 at kinetochores, suggesting the SKA complex plays a key role in spindle checkpoint silencing and the maintenance of chromosome cohesion in mitosis.

Specifications

• Accession Number: Q8IX90
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 221150
• Name: Human SKA3 (aa 327-412) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C13orf3; F630043A04Rik; RAMA1; RGD1307201; RP11-101P17.12-002; Ska3; spindle and kinetochore associated complex subunit 3; spindle and kinetochore-associated protein 3
• Common Name: SKA3
• Gene Symbol: SKA3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining