missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211635

Invitrogen™ Human SIT (aa 78-177) Control Fragment Recombinant Protein

Product Code. 30211635
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211635

Brand: Invitrogen™ RP102127

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53825 (PA5-53825. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIT (SHP2-interacting transmembrane adaptor protein) is expressed exclusively in lymphoid organs and acts either as a positive or as a negative regulatory element in T cell activation and in T cell development. Binding to Grb2 plays a pivotal role in signal transduction. Hubener et al. (2001) determined that the SIT gene contains 5 exons and spans 1.8 kb of genomic DNA. The SIT promoter demonstrated strong transcriptional activity and potential binding sites for both ubiquitous and lymphoid-specific transcription factors.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y3P8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27240
Name Human SIT (aa 78-177) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias gp30/40; MGC125908; MGC125909; MGC125910; RP11-331F9.5; SHP2 interacting transmembrane adaptor; SHP-2 interacting transmembrane adaptor protein; SHP2-interacting transmembrane adapter protein; SHP2-interacting transmembrane adaptor protein; signaling threshold regulating transmembrane adaptor 1; signaling threshold-regulating transmembrane adapter 1; SIT; SIT1; SIT-R; suppression inducing transmembrane adaptor 1; suppression-inducing transmembrane adapter 1
Common Name SIT
Gene Symbol SIT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.