Invitrogen™ Human SIRT5 (aa 48-141) Control Fragment Recombinant Protein

Product Code. 30199101

Brand: Invitrogen™ RP91734

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIRT5 is a human member of a family of proteins called Sirtuins (Sir2-like proteins) and are present in prokaryotes and eukaryotes. All Sir2-like proteins have a sirtuin core domain, which contains a series of sequence motifs conserved in organisms ranging from bacteria to humans. Bacterial, yeast and mammalian sirtuins are able to metabolize NAD and possibly at as mono-ADP-ribosyltransferases. The enzymatic function of sirtuins is not yet completely understood but recent reports of histone-activated Sir2-mediated NAD metabolism and NAD-activated Sir2-mediated histone deacetylation suggest a possible coupled reciprocal activation mechanism involving interactions of Sir2 with NAD and the N epsilon-acetyl-lysine groups of acetylated histones.

Specifications

• Accession Number: Q9NXA8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23408
• Name: Human SIRT5 (aa 48-141) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610012J09Rik; 1500032M05Rik; AV001953; FLJ36950; HAMAP-Rule:MF_03160}; hypothetical protein LOC507347; NAD-dependent deacetylase sirtuin-5; NAD-dependent deacetylase sirtuin-5-like protein; NAD-dependent lysine demalonylase and desuccinylase sirtuin-5, mitochondrial; NAD-dependent protein deacylase sirtuin-5, mitochondrial; NAD-dependent protein deacylase sirtuin-5, mitochondrial {ECO:0000255; Regulatory protein SIR2 homolog 5; regulatory protein SIR2 homolog 5 {ECO:0000255; si:ch211-121a2.1; silent mating type information regulation 2, S.cerevisiae, homolog 5; Sir2l5; sir2-like 5; SIR2-like protein 5; SIR2-like protein 5 {ECO:0000255; Sirt5; sirtuin; sirtuin 5; sirtuin type 5; zgc:92288
• Common Name: SIRT5
• Gene Symbol: SIRT5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining