missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211402

Invitrogen™ Human SIRT2 (aa 156-258) Control Fragment Recombinant Protein

Product Code. 30211402
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211402

Brand: Invitrogen™ RP89883

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SIRT2 protein (also known as Sirtuin for Silent Mating Type Information 2-Homolog) is a NAD-dependent deacytylase (NDAC) that has been shown to control gene silencing, cell cycle, and DNA damage repair. It is believed that SIRT2 may act as a tumor suppressor in human gliomas and may also serve as a novel molecular marker for these cells. SIRT2 has also been shown to act as a redox sensor to help regulate muscle gene expression in response to food intake and exercise. SIRT2 acts in the phosphorylation cascade involving mitosis where SIRT2 is phosphorylated in late G2 phase, during M phase, and into cytokinesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IXJ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22933
Name Human SIRT2 (aa 156-258) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730427M03Rik; 5E5 antigen; mSIR2L2; NAD-dependent deacetylase sirtuin-2; NAD-dependent protein deacetylase sirtuin-2; Regulatory protein SIR2 homolog 2; silent information regulator 2; silent mating type information regulation 2, (S.cerevisiae, homolog)-like; sirtuin 2; SIR2; SIR2L; SIR2L2; SIR2-like protein 2; sir2-related protein type 2; Sirt2; sirtuin 2; sirtuin type 2; sirtuin-2
Common Name SIRT2
Gene Symbol SIRT2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.