Invitrogen™ Human SIRT1 (aa 147-278) Control Fragment Recombinant Protein

Product Code. 30212666

Brand: Invitrogen™ RP106387

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NAD-dependent protein deacetylase sirtuin-1 (SIRT1) links transcriptional regulation directly to intracellular energetics and participates in the coordination of several separated cellular functions such as cell cycle, repsonse to DNA damage, metabolism, apoptosis, and autophagy. SIRT1 can modulate chromatin function through deacetylation of histones and can promote alterations in the methylation of histone and DNA, leading to transcriptional repression. It is essential in skeletal muscle cell differentiation and in response to low nutrients mediates the inhibitory effect on skeletal myoblast differentiation which also involves 5'-AMP-activated protein kinase (AMPK) and nicotinamide phosphoribosyltransferase (NAMPT).

Specifications

• Accession Number: Q96EB6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23411
• Name: Human SIRT1 (aa 147-278) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 75 SirT1; AA673258; hSIR2; hSIRT1; mSIR2a; NAD-dependent deacetylase sirtuin-1; NAD-dependent protein deacetylase sirtuin-1; OTTHUMP00000198111; OTTHUMP00000198112; Regulatory protein SIR2 homolog 1; RP11-57G10.3; SIR2; Sir2a; SIR2alpha; SIR2L1; sir2-like 1; SIR2-like protein 1; SIRT 1; SIRT1; SIRT-1; SirtT1 75 kDa fragment; sirtuin 1; sirtuin 1 ((silent mating type information regulation 2, homolog) 1; sirtuin type 1
• Common Name: SIRT1
• Gene Symbol: SIRT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining