missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SIRP alpha (aa 448-504) Control Fragment Recombinant Protein

Product Code. 30198966
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198966

Brand: Invitrogen™ RP106541

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIRP alpha (CD172a, signal-regulatory protein alpha) is a receptor-type transmembrane glycoprotein expressed on cells of myeloid origin, including granulocytes, dendritic cells (DCs), macrophages, mast cells and hematopoietic stem cells. SIRP alpha acts as a substrate for several activated tyrosine kinases, including EGFR, PDGFR, src and insulin receptor and is involved in the negative regulation of receptor tyrosine kinase-coupled signaling pathways. The ligand binding of SIRP alpha to integrin-associated protein CD47 results in tyrosine kinase phosphorylation of immunoreceptor tyrosine-based inhibitory motifs (ITIMs) within the cytoplasmic region of SIRP alpha, which mediates the recruitment and activation of the tyrosine phosphatases SHP-1 and SHP-2. Ligation of SIRP alpha with CD47 has been demonstrated in several regulatory processes, including the inhibition of host cell phagocytosis by macrophages and the bi-directional activation of T cells and DCs. SIRP alpha has regulatory effects on cellular responses induced by serum, growth factors, insulin, oncogenes, growth hormones and cell adhesion, and plays a general role in different physiological and pathological processes. Cancer cells highly express CD47, which activates SIRP alpha and inhibits macrophage-mediated destruction of cancerous cell growth.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P78324
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 140885
Name Human SIRP alpha (aa 448-504) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI835480; Bit; brain Ig-like molecule with tyrosine-based activation motifs; Brain immunoglobulin like protein with tyrosine - based activation motifs; brain immunological-like with tyrosine-based motifs; brain-immunoglobulin-like molecule with tyrosine-based activation motifs; CD172; CD172 alpha; CD172 antigen-like family member A; CD172A; Inhibitory receptor SHPS-1; macrophage fusion receptor; Macrophage membrane protein MFP150; MFR; mSIRP-alpha1; Myd1; MYD-1; myD-1 antigen; p84; Protein tyrosine phosphatase non-receptor type substrate 1 (SHP substrate 1); protein tyrosine phosphatase, non-receptor type substrate 1; Protein tyrosine phosphatase, non-receptor type substrate 1 (SHP substrate 1); Ptpns1; SHP substrate 1; SHP-1; SHPS1; SHPS-1; signal regulatory protein alpha; signal-regulatory protein alpha; signal-regulatory protein alpha-1; Signal-regulatory protein alpha-2; Signal-regulatory protein alpha-3; SIRP; Sirpa; SIRPalpha; Sirp-alpha-1; SIRPalpha2; Sirp-alpha-2; Sirp-alpha-3; swc3; swine workshop cluster 3 antigen; swine workshop cluster 3 antigen precursor; tyrosine phosphatase SHP substrate 1; tyrosine-protein phosphatase non-receptor type substrate 1
Common Name SIRP alpha (CD172a)
Gene Symbol SIRPA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.