Invitrogen™ Human SIMC1 Control Fragment Recombinant Protein

Product Code. 30194920

Brand: Invitrogen™ RP105939

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65196 (PA5-65196. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIMC1 (SUMO Interacting Motifs Containing 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene includeSUMO polymer binding. An important paralog of this gene isSKIDA1.

Specifications

• Accession Number: Q8NDZ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 375484
• Name: Human SIMC1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4732471D19Rik; C2H5orf25; C4H5orf25; C5orf25; FLJ44216; oocyte maturation associated 1; OOMA1; platform element for inhibition of autolytic degradation; PLEIAD; Simc1; SUMO interacting motifs containing 1; SUMO-interacting motif-containing protein 1; SUMO-interacting motifs containing 1
• Common Name: SIMC1
• Gene Symbol: SIMC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YVIDLTRAEGENRPIATLDLTLEPVTPSQREPTSLQTCASLSGKAVMEGQVDRSSQPTARRLINSDPVDLDLVEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining