missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SIK2 (aa 665-739) Control Fragment Recombinant Protein

Codice prodotto. 30197595
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Questo articolo non è restituibile. Consulta la politica di reso

Codice prodotto. 30197595

missing translation for 'mfr': Invitrogen™ RP109238

Please to purchase this item. Need a web account? Register with us today!

Questo articolo non è restituibile. Consulta la politica di reso

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SNF1LK2 (QIK) is a serine/threonine kinase and is a salt-inducible kinase that belongs to the AMP-activated protein kinase family. SNF1LK2 negatively regulates CRE-binding protein (CREB) activity by phosphorylating the CREB-specific coactivator transducer of regulated CREB activity (TORC). SIK2 is thought to be part of a signaling cascade that regulates the expression and activity of the insulin-induced genes PGC-1'alpha and UCP-1 in brown adipocytes, impairment of which has been implicated in obesity and insulin resistance in human and animal models. SIK2 has also been reported as a key regulator for neuronal survival after ischemia, suppressing CREB-mediated gene expression after oxygen-glucose deprivation.
TRUSTED_SUSTAINABILITY

Specifica

Accession Number Q9H0K1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23235
Name Human SIK2 (aa 665-739) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias G630080D20Rik; KIAA0781; LOH11CR1I; QIK; Qin-induced kinase; RGD1559698; salt induceable kinase 2; salt inducible kinase 2; salt-inducible kinase 2; salt-inducible protein kinase 2; salt-inducible serine/threonine kinase 2; serine/threonine-protein kinase SIK2; Serine/threonine-protein kinase SNF1-like kinase 2; Sik2; SIK-2; SNF1-like kinase 2; SNF1LK2
Common Name SIK2
Gene Symbol SIK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato