missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208356

Invitrogen™ Human Sigma-1 Receptor (aa 116-217) Control Fragment Recombinant Protein

Product Code. 30208356
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208356

Brand: Invitrogen™ RP90623

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99720
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10280
Name Human Sigma-1 Receptor (aa 116-217) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AAG8; Aging-associated gene 8 protein; AL024364; ALS16; DSMA2; hSigmaR1; mSigmaR1; opioid receptor, sigma 1; Oprs1; RP23 167I12.6; SIG 1 R; SIG-1 R; sigma 1 receptor variant SR-1 D; sigma 1-type opioid receptor; Sigma non-opioid intracellular receptor 1; sigma1 receptor; Sigma-1 Receptor; sigma1R; sigma1-receptor; Sigmar1; SR BP; SR31747 binding protein 1; SR31747-binding protein; SRBP; SR-BP; SR-BP1; zgc:56378
Common Name Sigma-1 Receptor
Gene Symbol SIGMAR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.